PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0308s0280.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 395aa    MW: 44590.6 Da    PI: 6.4239
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0308s0280.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1851.8e-57161421128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdee++++yL++kv ++++ + ++i evd++k+ePwdLpkk+k +ekewyfF++rd+ky+tg r+nrat+sgyWkatg
  SapurV1A.0308s0280.1.p  16 LPPGFRFHPTDEEIITHYLTEKVMNSSFCA-SAIGEVDLNKCEPWDLPKKAKMGEKEWYFFCQRDRKYPTGMRTNRATESGYWKATG 101
                             79*************************988.88***************99999********************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             kdke+++ +++lvg+kktLvfy+grapkgek++Wvmheyrl
  SapurV1A.0308s0280.1.p 102 KDKEIYRGRTSLVGMKKTLVFYRGRAPKGEKSNWVMHEYRL 142
                             *******99******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.1E-6312167IPR003441NAC domain
PROSITE profilePS5100560.01716167IPR003441NAC domain
PfamPF023656.5E-3017142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MEEAIVVNKG DDLIDLPPGF RFHPTDEEII THYLTEKVMN SSFCASAIGE VDLNKCEPWD  60
LPKKAKMGEK EWYFFCQRDR KYPTGMRTNR ATESGYWKAT GKDKEIYRGR TSLVGMKKTL  120
VFYRGRAPKG EKSNWVMHEY RLDGKFSYYG LPKASRNEWV VCRIFHKSTG VKKSSIHEIQ  180
RMNSFGDDFL DYSSLPPFMD VNQNSRPSTS SFNGGDDNEF KAMAEKSPDG NYFSSTSMLN  240
NNQNFVHPAN TIYQAPDSSF QYPHQIPASN PLYNFQTNPN MAGYFHQGKI CNSFANFQNS  300
SFCNNDQTLL RSLARNSYGG ASGLEKQCKV EQFSSNQSMV SLSQETGLST DVNTNTEISS  360
VVSKQEIGSH DKVFDDLEGP SAGPIADLDC LWDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-531417315171NAC domain-containing protein 19
4dul_A2e-531417315171NAC domain-containing protein 19
1ut7_B2e-531417315171NO APICAL MERISTEM PROTEIN
1ut7_A2e-531417315171NO APICAL MERISTEM PROTEIN
1ut4_B2e-531417315171NO APICAL MERISTEM PROTEIN
1ut4_A2e-531417315171NO APICAL MERISTEM PROTEIN
3swp_D3e-531417318174NAC domain-containing protein 19
3swp_C3e-531417318174NAC domain-containing protein 19
3swp_B3e-531417318174NAC domain-containing protein 19
3swp_A3e-531417318174NAC domain-containing protein 19
3swm_D3e-531417318174NAC domain-containing protein 19
3swm_C3e-531417318174NAC domain-containing protein 19
3swm_B3e-531417318174NAC domain-containing protein 19
3swm_A3e-531417318174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006371151.10.0hypothetical protein POPTR_0019s04710g
TrEMBLU5FEC80.0U5FEC8_POPTR; Uncharacterized protein
STRINGPOPTR_0019s04710.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-113Arabidopsis NAC domain containing protein 87